LSD1, Human Recombinant, 100 mg lysine-specific demethylase 1
Item No.
61171197
LSD1, Human Recombinant Protein Ordering Info: Part Number Size (mg) 61171196 10 61171197 100 61171198 500 Product Number: P010H.1 Product Type: Active recombinant protein Function: Modifies histone H3 by demethylating Lys-4 and Lys-9, acting thereby as a coactivator or a corepressor Synonyms:
Description
LSD1, Human Recombinant Protein

Ordering Info:
Product Number: P010H.1
Product Type: Active recombinant protein
Function: Modifies histone H3 by demethylating Lys-4 and Lys-9, acting thereby as a coactivator or a
corepressor
Synonyms: KDM1A, KIAA0601, AOF2, BHC110, CPRF
UniProt: O60341
NCBI: NP_001009999.1, NM_001009999.3
Organism: Human
Host: Escherichia coli
Tagging: N-terminal 6xHis
Region: 172-836
Sequence: SGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATL
QQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTL
Calculated MW: 74.8 kDa (including tag)
Preparation: five-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 200 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme activity has been validated in peroxidase-coupled assay with methylated histone H3
tail peptide (H3K4Me2) (Forneris et al, 2005)
Storage: -80C
Shipping: shipped on dry ice
Keywords: Excella
Ordering Info:
| Part Number | Size (mg) |
|---|---|
| 61171196 | 10 |
| 61171197 | 100 |
| 61171198 | 500 |
Product Number: P010H.1
Product Type: Active recombinant protein
Function: Modifies histone H3 by demethylating Lys-4 and Lys-9, acting thereby as a coactivator or a
corepressor
Synonyms: KDM1A, KIAA0601, AOF2, BHC110, CPRF
UniProt: O60341
NCBI: NP_001009999.1, NM_001009999.3
Organism: Human
Host: Escherichia coli
Tagging: N-terminal 6xHis
Region: 172-836
Sequence: SGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATL
QQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTL
Calculated MW: 74.8 kDa (including tag)
Preparation: five-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 200 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme activity has been validated in peroxidase-coupled assay with methylated histone H3
tail peptide (H3K4Me2) (Forneris et al, 2005)
Storage: -80C
Shipping: shipped on dry ice
Keywords: Excella
Item Info:
| Item Title | LSD1, Human Recombinant, 100 mg lysine-specific de |
| methylase 1 | |
| Sales Unit of Measure | EA1 |
| Last Date/Time Modified | 3/20/2024 9:22:50 AM |
Cytosep™ Double Funnel w/White filter Paper & CapI
Item No.
42012803
$841.00